PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT13043
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 181aa    MW: 20791.6 Da    PI: 8.2292
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT13043genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding223.9e-07911281047
                      HHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  10 ellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +l++++   +G g Wk I++ + +++t+ q+ s+ qky
         EMT13043  91 KLFLQGLGVYGRGKWKEISKDFVTTKTPVQVSSHAQKY 128
                      68999999*****************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.75E-1090134IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-991131IPR006447Myb domain, plants
CDDcd001674.74E-491129No hitNo description
Gene3DG3DSA:1.10.10.602.7E-593136IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MKARFEVEDP EPVITGFNNT DHSCDGVNHD KNEKPDGLEL RLWWPCETMQ QEGIRVMEEG  60
KQATMLVGNK VKVPENGMSI HQPVIVPSAR KLFLQGLGVY GRGKWKEISK DFVTTKTPVQ  120
VSSHAQKYFR RIKKGEQERQ RYSINDLELK IVKPWTIGNN SSAYRSPIFD DADNHNQSFD  180
M
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010229882.22e-31PREDICTED: transcription factor DIVARICATA-like
TrEMBLN1R2991e-135N1R299_AEGTA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP84230133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.14e-17MYB family protein